Yeast mitochondrial code

 The yeast mitochondrial code (translation table 3) is a genetic code used by the mitochondrial genome of yeasts, notably Saccharomyces cerevisiae, Candida glabrata, Hansenula saturnus, and Kluyveromyces thermotolerans.^[1]

The codeEdit

   AAs = FFLLSSSSYY**CCWWTTTTPPPPHHQQRRRRIIMMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Starts = ---M---------------M---------------M---------------M------------

 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V).

Differences from the standard codeEdit

DNA codons	RNA codons	This code (3)		Standard code (1)
ATA	AUA	Met (M)		Ile (I)
CTT	CUU	Thr (T)		Leu (L)
CTC	CUC	Thr (T)		Leu (L)
CTA	CUA	Thr (T)		Leu (L)
CTG	CUG	Thr (T)		Leu (L)
TGA	UGA	Trp (W)		STOP = Ter (*)
CGA	CGA	Absent		Arg (R)
CGC	CGC	Absent		Arg (R)

• The remaining CGN codons are rare in Saccharomyces cerevisiae ^[2] and absent in Candida glabrata.
• The AUA codon is common in the gene var1 coding for the single mitochondrial ribosomal protein, but rare in genes encoding the enzymes.
• The coding assignments of the AUA (Met or Ile) and CUU (possibly Leu, not Thr) are uncertain in Hansenula saturnus.
• The coding assignment of Thr to CUN is uncertain in Kluyveromyces thermotolerans.

This article uses material from the Wikipedia article  Metasyntactic variable, which is released under the  Creative Commons Attribution-ShareAlike 3.0 Unported License.